SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50123023|ref|YP_052190.1| from Pectobacterium atrosepticum SCRI1043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50123023|ref|YP_052190.1|
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily HAD-like 4.4e-44
Family YihX-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50123023|ref|YP_052190.1|
Sequence length 228
Comment hydrolase [Pectobacterium atrosepticum SCRI1043]
Sequence
MNPHVNWHDIDTVILDMDGTLLDLAFDSYFWLQLVPQSLSEKRHISLEQAHQLIKHEYKA
VQHTLNWYCFDYWSERLDLDIYQMTTDIGTRARLRDDTTPFLAALREYGKETILLTNAHP
HSLAVKIEHTGLDQHLDLLLSTHTYGYPKENQRLWQAVQQQTGFNPARTLFVDDSEPILD
AAKTFGIHYCLGVRNPDSGQQEKAFLQHPSMNDYLALLPALRHSVNVG
Download sequence
Identical sequences Q6CZP8
gi|50123023|ref|YP_052190.1| WP_011095576.1.32123 WP_011095576.1.57850 WP_011095576.1.77917 WP_011095576.1.79946 WP_011095576.1.94180 218491.ECA4103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]