SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_3952.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_3952.1
Domain Number 1 Region: 146-241
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000242
Family Protein kinases, catalytic subunit 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MLOC_3952.1
Sequence length 247
Comment pep:novel chromosome:030312v2:5:512811136:512814717:1 gene:MLOC_3952 transcript:MLOC_3952.1 description:"Uncharacterized protein "
Sequence
MPELRSGVRRARLRSSRLEDVQAADQVAAPVLPAPRGRGGRRGGGAAGRGNKKAVAAGRG
RPAPKARGKRVEAIDLADQPFEDIPEAIVGEAVAGTAQQVLGLNKVADRAANFKMEGASG
DRLAAAEDEATTTPVPERVQVGGSPEYITDRKLGKGGFGQVYVGRRITGGASRTGPDAYE
VALKLEHRRSKGCSYGPPFEWQVYQSLNGCYGIPSVHYKGRQGDYYILVMDMLGPSLWDV
WNSMGQA
Download sequence
Identical sequences MLOC_3952.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]