SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_57180.2 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_57180.2
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-33
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MLOC_57180.2
Sequence length 122
Comment pep:novel chromosome:030312v2:2:588123778:588125197:1 gene:MLOC_57180 transcript:MLOC_57180.2 description:"Uncharacterized protein "
Sequence
MARLRHGNLVHLLAYCNEGDEGILVYVYMPNKSLDLYIFGEPSLRATLSWRKRLDIIHGI
AQGVAYMHEGSGESVVHRDLKLQNVLLDENWRAKVADFGTAKLFVAERADSSLTIVNSPW
FY
Download sequence
Identical sequences MLOC_57180.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]