SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_51142.2 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_51142.2
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 8.89e-23
Family Rap30/74 interaction domains 0.0045
Further Details:      
 
Domain Number 2 Region: 191-257
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.17e-20
Family DNA-binding domain from rap30 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MLOC_51142.2
Sequence length 265
Comment pep:novel chromosome:030312v2:3:452440418:452444083:1 gene:MLOC_51142 transcript:MLOC_51142.2 description:"Uncharacterized protein "
Sequence
MAEEGKHLETGRADRSVWLMKCPTIVSRAWQKAAAAAAAADAGGPSPNPNPVVAKVILSF
DPLSTDEDPNQFKMEMAQTDNGNTPKNYSLNMFKDFVPMCVFSESNQGKLACEGKVEHKF
DMEPHKENLSDYAKLCRERTKNSMIKTRKVHVLDKEHVNVRTMISMIGGGPHSGPKDKKK
PAPTRTPEVKRTRRDRGDIENILFKLFERQPNWSLKHLMQETDQPEQFLKEIMNDLCVYN
KRGPNQGTHELKPEYKKSVEDTSAT
Download sequence
Identical sequences M0WG18
MLOC_51142.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]