SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_53350.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_53350.1
Domain Number 1 Region: 121-187
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-21
Family DNA-binding domain from rap30 0.0031
Further Details:      
 
Domain Number 2 Region: 10-55
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000366
Family Rap30/74 interaction domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_53350.1
Sequence length 196
Comment pep:known chromosome:030312v2:1:425543016:425546506:1 gene:MLOC_53350 transcript:MLOC_53350.1 description:"Uncharacterized protein "
Sequence
MEMSQTSVASTCNLPKSYSLNMFKDFVPMCVFSETNQGKLSCEGKVEHKFDMEPHKDNLL
NYAKLCRERTQKSMVKTRKVQVLDNDHGMSMRPMPGMVGLISSSSKEKRKPTPTKPSDVK
RTRRDRRELENIIFKLFEKQPNWALKALVQETDQPEQFLKEILNDLCMYNKRGPNQGTHE
LKPEYKKSSEDAAGAP
Download sequence
Identical sequences M0WP12
MLOC_53350.1 MLOC_53350.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]