SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_57360.2 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_57360.2
Domain Number 1 Region: 269-344
Classification Level Classification E-value
Superfamily HMG-box 7.46e-22
Family HMG-box 0.00054
Further Details:      
 
Domain Number 2 Region: 396-473
Classification Level Classification E-value
Superfamily HMG-box 1.19e-21
Family HMG-box 0.00095
Further Details:      
 
Domain Number 3 Region: 140-215
Classification Level Classification E-value
Superfamily HMG-box 6.41e-19
Family HMG-box 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_57360.2
Sequence length 479
Comment pep:novel chromosome:030312v2:2:574696900:574699182:-1 gene:MLOC_57360 transcript:MLOC_57360.2 description:"Predicted protein\x3b Uncharacterized protein "
Sequence
MATVAATESRRSGRSRKALAPVPDNDANISAGGADLAAALPPQPHKAKDAAPSMSDELTE
LQGMLERLRLEKEKAEEMVRERDEVIRKKEEELETKGKQQERLQAELKKMQRVKVFEPTM
NFPLAQSLLGKDHEEGGDKGKKKKKGKGKAGNERKKPAPAYILWCKDQWAEIKKSPDTDF
KEVTNALGAKWKTLSNEEKQPYEERYRQEKEAYLQVVGQEKREAEAMKLLDEEQMRWTAK
ELLGQYLKFRQEAEGDGNSKKAKNKMKKAKDPSKPKQPMSAYFLYSQERRGALVAEKKTV
PEIGKITGEEWKGMTEAQKAPYEEAARKQKEAYQKQMEVYNQKKLGENASLEKEEEEQKK
ILKQEALQLLRKKEKADNIIKKTKEKRQKKKQQNADPNRPKKPASSFLLFSKEARKQLAE
ERPGVNNSTLSALISVKWKDLSSAEKKVWSQKAAQGMAAYKMEMDEYTKAHTSSSSTIA
Download sequence
Identical sequences MLOC_57360.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]