SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_57633.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_57633.1
Domain Number 1 Region: 127-207
Classification Level Classification E-value
Superfamily HMG-box 3.4e-22
Family HMG-box 0.00037
Further Details:      
 
Weak hits

Sequence:  MLOC_57633.1
Domain Number - Region: 34-106
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00162
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MLOC_57633.1
Sequence length 247
Comment pep:novel chromosome:030312v2:6:412756935:412758677:-1 gene:MLOC_57633 transcript:MLOC_57633.1 description:"Uncharacterized protein "
Sequence
MRLAVLRNANPPCAHAYPQPRNGKHSAHASQRLHPPNPHRCPLSPVSRTPTRPRGPAPHN
GSPQSQQTQHQQPQPFPPTLPNQSAPLLRSAPPQNPSSVPSAASTMKGKADASKKGEGRL
KAAGGASKRKKAAAAAGKPKRPPSAFFVFMSDFRQQYNAENPNNKNVANVSKAAGEKWRS
MSDEDKAPYVEKAGQKKQDYEKTKASFENKESVSSKKAKTQDDEEAEGSKSEVEDEGSDE
DNEDDDE
Download sequence
Identical sequences MLOC_57633.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]