SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_58640.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_58640.1
Domain Number 1 Region: 60-154
Classification Level Classification E-value
Superfamily SH3-domain 9.42e-17
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 5-52
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000471
Family BAR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_58640.1
Sequence length 166
Comment pep:novel chromosome:030312v2:2:521463305:521464814:-1 gene:MLOC_58640 transcript:MLOC_58640.1 description:"Uncharacterized protein "
Sequence
MVGLGKEAVSAMAAVEGQQQRLTLQRLIAMVEAERTYHQKVLEILDHLEEEMVSERQKIE
APPPPAAESYTSPPPPSYDEVNGMFASTSADQAVNSVDLFLGEALDSFKAESEFELNLSV
GDIVIVRKISSNGWAEGECKGKAGWFPHAYVERRERVLASKVPHIF
Download sequence
Identical sequences MLOC_58640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]