SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_65440.3 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_65440.3
Domain Number 1 Region: 311-609
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-76
Family Protein kinases, catalytic subunit 0.0000926
Further Details:      
 
Domain Number 2 Region: 197-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  MLOC_65440.3
Domain Number - Region: 164-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0407
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_65440.3
Sequence length 675
Comment pep:novel chromosome:030312v2:1H:6192949:6199263:1 gene:MLOC_65440 transcript:MLOC_65440.3 description:"Uncharacterized protein "
Sequence
MLSNGNELVLSGCNLLATLVEDLGVGPGRSGIISGCASFCSFRNKKVDSVGQPAGKYCSG
MACCQAPINYHSSPTGVHLRWLDAGNHSEALTFLPTYVFVAEEGWFDRRPLADELLSVRR
SPSEAALEVPLVLLWAVKQGLPPLPSLTANSSTACSDDTHRMLCKSGHSVCAAGNLGYTC
QCRDGYDGNPYLTHGCQDVNECEQPHDHGCFGKCINTIGGYKCQCPQGTHGNYTIKDGCI
KSAATGTSIGIGVGSAVGFMLLVLGAIFMVQRFQHKREMLLKQKFFKQNRGQLLQQLVSP
RTDIAERMIIPVDELAKATNNFDKARELGGGGHGTVYKGILSDLHVVAIKKSKITVQKEI
DEFINEVAILSQINHRNVVKLIGCCLETEVPLLVYEFISSGTLYDHLHVEGSKSLPWVTR
FRIATEIASALAYLHSSVSIPIIHRDIKSSNILLDESMTSKVSDFGASRYIPTDKTGLTT
MVQGTIGYLDPMYFYTGRLTEKSDVYSFGVILVELLTRKKPFSYFFLDGDGLVAHFVKLL
AEKMLVQILDPQVIEEGGKEVHELSILAASCIKLNAEDRPTMRQVEHTLEGLVVTRKFLE
NDITMMNCSLNKERKSPLECSRRHSMEEEILMSARQAQGTQGHGVGREAISLCLLPMFWS
GASHNPDYATAFMFT
Download sequence
Identical sequences MLOC_65440.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]