SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_73988.2 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_73988.2
Domain Number 1 Region: 44-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.63e-24
Family Arfaptin, Rac-binding fragment 0.089
Further Details:      
 
Domain Number 2 Region: 267-286,335-370
Classification Level Classification E-value
Superfamily SH3-domain 0.00000118
Family SH3-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MLOC_73988.2
Sequence length 371
Comment pep:novel chromosome:030312v2:1:208879893:208883540:-1 gene:MLOC_73988 transcript:MLOC_73988.2 description:"Uncharacterized protein "
Sequence
MEAIRKQASKLREQVARQQQAVLKQFGGGYADSVFADEGEAQQHSKLEKLYISTRAAKHF
QRDIVRGVEGYIVTGSKQVELGNKLCEDGKKYGVENTCTSGSTLSRAALSFAKARSLMEK
ERGNLLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKLRET
SGNGDMISRLEAAESKLQELKSNMGTLGKEAVAAMTAVEAQQQRLTLQRLIAMVESERSY
HQRVLQILDQLEREMVAERQRIEGAPPPVIENSMPPPPSYEEVNGIFMRTPTVAELVETV
EHFLAEVTNYYFHHNELAYYCYVCWDFLLNRYTCPSFRQAIQSYRAETETELNLATGDYI
VVRKVSNNGWA
Download sequence
Identical sequences MLOC_73988.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]