SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_77667.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_77667.1
Domain Number 1 Region: 96-161
Classification Level Classification E-value
Superfamily HMG-box 2.23e-19
Family HMG-box 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_77667.1
Sequence length 215
Comment pep:known chromosome:030312v2:7HL:19889007:19890464:1 gene:MLOC_77667 transcript:MLOC_77667.1 description:"Predicted protein\x3b Uncharacterized protein "
Sequence
MATAGNAPRSRKRVEATVLKRARDGSAFTRCEACNKDVAIVLIDLHSCSLDSKIRLSLES
QVVEKAVEVQEKKRKAPPAAAGGKGKKKSKADGDGAKKAKAKRPPTAFFLFMKDFRVEFK
TSHPDEKGVAAVGKAAGEKWRSMTEEEKKPYNDQAKELKAQLDNGEGSAENNVGDEEKAD
ADAEEVDDADLEVDKQEDAPEDEEEEEKNELDDDI
Download sequence
Identical sequences F2EKM1
MLOC_77667.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]