SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|57233597|ref|YP_180800.1| from Dehalococcoides ethenogenes 195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57233597|ref|YP_180800.1|
Domain Number 1 Region: 7-101
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000138
Family Di-heme elbow motif 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|57233597|ref|YP_180800.1|
Sequence length 148
Comment redox family protein [Dehalococcoides ethenogenes 195]
Sequence
MSDTAVSAQSLHEQGFNCAQSILGAFAPSLGIETGTAFKLASAFGGGMAGRGDSCGVISG
GLMVIGLKFGQTSAEDKAAREKCNRLGREYIKQFETRFGATACRELIKCNIGTPEGAKLV
KEKGLREGLCSNLVYSGAQMLSALIEQA
Download sequence
Identical sequences Q3ZAE9
gi|57233597|ref|YP_180800.1| WP_010935855.1.69666 243164.DET0045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]