SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|57234461|ref|YP_181490.1| from Dehalococcoides ethenogenes 195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|57234461|ref|YP_181490.1|
Domain Number - Region: 20-119
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000496
Family Di-heme elbow motif 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|57234461|ref|YP_181490.1|
Sequence length 122
Comment hypothetical protein DET0757 [Dehalococcoides ethenogenes 195]
Sequence
MIVLFGNKAYYDILGYMVTTCPGCKTTSVMTVEQQRKKLTVYFIPTFDFSRKQYMYCGHC
HERFEIDKSLQSTVKARLLSKKQMENLIQQLEMETPRYECANCEARVEAGMRFCPQCGNS
LG
Download sequence
Identical sequences A0A0V8LY04 Q3Z8F9
WP_010936491.1.26930 WP_010936491.1.40429 WP_010936491.1.4711 WP_010936491.1.69666 WP_010936491.1.98386 gi|57234461|ref|YP_181490.1| 243164.DET0757 2014766501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]