SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339498669|ref|YP_004696704.1| from Spirochaeta caldaria DSM 7334

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|339498669|ref|YP_004696704.1|
Domain Number - Region: 253-321
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0173
Family Arfaptin, Rac-binding fragment 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339498669|ref|YP_004696704.1|
Sequence length 548
Comment hypothetical protein Spica_0024 [Treponema caldaria DSM 7334]
Sequence
MNNNMFQGDIDPDLAALLGVSTSQAGPSESNTTPNYKDLFGTEDIETPNGIEVDLTQNTF
PEITKPFATIPLTVFSDPDYYKKALSGEGDIAQRVHTILQKFLTTKDPKDRGVYRQQLTT
AYWDFLLGIARKTPGKIPDNKKFLLRYGILHPGLLTPEDKELFSKIIVDNELNQPIYYLD
EWFKAIGTGVIKNSTTDEVRVAKNNEATRLKQLLEKAEGRRDAARNLLKAKSDERASYEK
ALVNAVQIIAQHSPIPGFPDLQSVYNEVQKRAFSEIQELLKNMAKADRELDSLLKEFSQA
QADVQILEDKVREAGADVAVDIKAIDTEFDSVRQMVKLTIGRQGNHFPILVKEYFHCGPN
EIATRENVIKQLAWIESIDPEAFCRVYKNKLNRIVPYVILVPSYGEFGICWEPFDRFNRA
TSRGRIAIPLYPKNLNLAILSAVGDLRWQNAKEKASYYWMEEGITGNYYQWFTSKKLKGD
VKEYFIQDYILWMTKESEGIQKLDKEVRGIFWRYIPFSQSIKDKLRGRSYVYQELYQRDI
NRSLSDGY
Download sequence
Identical sequences F8EWN3
gi|339498669|ref|YP_004696704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]