SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339499688|ref|YP_004697723.1| from Spirochaeta caldaria DSM 7334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339499688|ref|YP_004697723.1|
Domain Number 1 Region: 684-771
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000767
Family Arfaptin, Rac-binding fragment 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339499688|ref|YP_004697723.1|
Sequence length 3676
Comment hypothetical protein Spica_1067 [Treponema caldaria DSM 7334]
Sequence
MNSKKQKVSLIGICMFLGLVTTLVADPKPDVRGFDRSGFEYSFSRADQTLDPAAWINEVK
LGIAIARKNWEQLALTLYDDVVEREHAGKALDQWTETELQQRFAQWLERRFLIEQGLSLA
SRTSKAVQQANLLYLYKTDQDGSILYDEATGDPEVIRPDGDNPDKLLADQAAWNAQVAQS
KEESLQYYRSILTALSPELLAYLEPEQRAAFAQQLENLQDRLVQRKQKELEALVAQEERI
FIARRTGDVWSLRKKSESEAAAAIVADLIRETKSSCDQSLASLETKIESASAGTGDLALM
GTQWLEAYKEQFQRGIDAWQKAEERFMVRRIEWEQQAGKRFTEGETAWSEAFEKLNKEQQ
AWEAKARILFQAGEETFKRASETLERAITEAKAEFQKDADLRSQASADRARAWVDTYVTS
ATMVLSARESSQYWIDKLKSKNTSSPPAIGDPALRSWVDGALKNVWKQAQQSYEKQYSND
FNALQNKKHESEWTRADIERFYQEEARKYPLFYNNSNTNIWSTWLENYDAKHAQAVAEYQ
NALAAFHEKHALYFRITEAVATIPEEAQALTLAGDCKTLLGAAFDPDLIQAGVEIKRWMQ
IYTTYADRAREAMETLTRDFDLAIGSGSGALIDVLDNAKTSEDFHLDEYQIELLRAKAVA
GYWARRVDIAQAVARYAEDLTAGRTTDAESVAAWKASKARYDTALADYKAAQEALSSAST
DVAASRDRLTKAAAALAQADEELEALNQEYALKMSLLAVGSADYLKSELKEKYKSLLETY
GLLQKTGDEAPYVTYLERAKQYGLAESIEQTGLILKSLVTGAYGEPAISDLSRRYSALYI
PEDEKPLLQTFEALGVDEHSSNYGALKSVYEAWKTSTGEEQQHYDRLIRALLLQARDEAQ
AALETRLDSISLLSSSTWDEWYRSRGGITDPGTPLTEDSIGQTLIEDMEQAARVYLAKRV
EQELALLGYFLDPMGSVSEELKTMVSLSTLGSTIDTATAAALVQSLTLLQQKLKSLTDEN
PAEYRKQLEALAKTDQRIAAFLRGESACVTATGLDLVGLMLQKERMALERTRGRQLAYER
YGSMGYLGAQAEQTRAWQNVTRCFTELGMATNLPYGQLPSPSVLGKQFITAAQGPEQALG
TFLAALDQAMEGMPTWLKADLSFWKDALISYVAAKARYSGTSILPENPQNLMDQLKGIQE
KQVAYQNLLQTLYTAPTDDARLICALLADGSPSYGEVPRDLLEQEAVHRIARSLLAKAGD
LSALEESERRTRLMNDADSNHGYASGAVRTQAVTKALEDLAIQMALINKPDPATLQGEVR
TQRLYQIYGELDLQGLASLVQEGLASLDFDQLHPADITSDTIGTWLPYLKTYLDRLHNAA
GSAAVYEARAICLLLADQLKNYPDHLAAMLTALDLQAQGTAQTLIQLVNGQDYQLERELF
IGIEENNPYYETGILYYLKKRAYQSIPENYEQEQDLVLDRLIKGGKTALVHRIRIELERF
SRLINLSRAYGGTDVSGDTLSYARRQTGLSLEDQFALSRLINTGTLQDSFMKSLGLAEVQ
AGPQDGYTQWLATYLQGELNRYGSERARLQGRLAYAQTYEAQDEEKASSNWRVYLKESIF
TQNGDTATALDEIPWTDSGTPECEGNNPRSAENWKEGTLADAFDRINLATRNLQASFTAW
NEQLALLTAEQGYREKIRTYLEQPETTWNEDSIQYLPALVQDGYSNEHNQYRYSLSRLEG
EQRELGRLGAAIKNYKGNESLKKEIDVLARAIADKQNAYQEQANEYAAAAETFAAEGEIY
EQRYRTAKQYYEALEQARLAYEKEDAIRRWASTSYLGSDDNSSLNYRGPTAELAYTQERK
TRASIALKALQDLYATSATSRPYTDDTYNALYQEYQASFDRMMLTLKVKDLVSSELTKEY
ERNQKLYEEYYKMLFAGDGTSNPFATPITYEEQYQVPTEVSKRSWKDIITLKNGKLSLAY
DSDFKISTLDATQIETLKDFFETKETVGTDQHESTAFERSLRDLVTRLSSYNFTADKLQQ
WGLARDYLIKKLIEKNKDQLPFLQDAYHLADNLYNNEGNFEVHYEKLRDRMDYYRAGTQP
IYQWEIDPETGKSKQVLIGYTDPGLPEAQKNAWQSLTNEEKSDLEYLALLCVTHGGGTLT
GILNDMTEYTEYKVMDKIVTRWKNWEARRRSNLFYGWWAKIEYGKLKDCQNHYRGAWDSL
QNKMTNGVIYLNKQPKDLKIKMSEYTISSNRIAALEGKKSAGETFSWADLEKALIASGKL
NSNELVKMKQYWETSALAGSGEITNVSEALAKLSSWGRSTRDDAKRKLNTRWQDDETERQ
AAQQQYRDTLETYIAGKASKADLDAAARAAYGDEAASQKTHLAKLVGVYEDNLESMLNGS
SAYQREYAQLGQELADSIGQTYRARFAAELAAREAEWNEERRDLQEKQAAWREAAGLILE
RGRADWKAGAERLRDSYTSWKKSFAEAYAQGSAAWDGAYLEGLKEKEAWAERATAAATTA
ASEAMLALVGQDAEAGARTFDTLGFVADLSSGAEEAKAGIRDVLSLAGIVNLTSALNASM
GSAETAVSQVRTGLGGLGLWDSGKAQVAAARFTKEANQELASRQARLVAAQARDMAQASI
KGLEEQVQKANENFRESMDETFVLKGSWRKEGQHYRKDVVVYSTLLDPVVTEAASVQGYI
AYLMQPVSLRTDLSDTKLAQLEYSAIQALIGQAQKEVQEASEKIFGSEADNSEEAKAKRK
VVYEVNKTKTVATDLWTMLTTFKTTQEVIEETNHEEREAGAGEFGAHIGYAPVTKGNPNV
DDGLDNIWIDKGTGELGRLMRSYIYWSMKESQGWASVNKPMWDKPAWDDRSSWFKAPTIR
GITDIGVTIAASVMLPGAGSLLMNAALNLADDAVFTMLDVGGGYKSWEEAGLEFTKKAAC
SAVNVGVGGVFNGFGGVSNSFFPQGNGLSGMVSSIAGTGPMGVIANTAMTGLQTLTTSTL
NSAVNAITWDKDHGLGWSADAFNAGVQGGLISAATGMTSSLTSGMLNLGLEGFVGKTYAN
AATLSNTIGSLAGQGVNYALTGAFTLNVLNFGMFGIQDRNGNLVKNGLLELHLGRNGATM
NVGMGGADVSLGTVAQSIAGLDAWRVNAELWTSKQDEAHKYTSGMRTLYSVGGAQELALY
QELLSGKTNIEELADGDYKAKTEANGDGTKTIYLGQGALADGSRFGLNILLAHEAYRNGK
DDGTEGQRQETQQAVLGHIGAALALSQVYGMGSIGEAMTGEVNTYLKTLQSNDFGELGKL
LAGYDASGDYWRLKKDGSLVYDGFATLRDEDGNIIRSAAEMGVKETQIEGSLIKILGVDP
KNKSQVEAVRRLMISAGIQHSYSSDSEQWRWGGEHTVVIGSRGSFPVTATLNLTTVNEGK
SITLEGINNFYTTIGASKEQVNSFIKNTYGSAIGMLNYAGLEYRTSAEQMLAKVYSANDI
KKIETNQAWYNNAIQNGIVVDAMVTGGAIRTTNFGVNTGDLPLTTSSVAGAAFFEEWHTG
IDYGSGGISVQTPGGYWELYDRVEHRAYFQLFGGDIRMRIMHIDPKEINKLQLGAIYGQG
TDIQKLFDYPKESYGSGTEAHVHIDFTRWLPYQGNYNRQFVNPETLKPGSIFNYAYSYKD
SQKKVLPGYPSNFYRY
Download sequence
Identical sequences F8EXI8
gi|339499688|ref|YP_004697723.1| WP_013968526.1.55161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]