SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319789875|ref|YP_004151508.1| from Thermovibrio ammonificans HB-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|319789875|ref|YP_004151508.1|
Domain Number - Region: 38-94
Classification Level Classification E-value
Superfamily Prefoldin 0.0445
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319789875|ref|YP_004151508.1|
Sequence length 187
Comment Fimbrial assembly family protein [Thermovibrio ammonificans HB-1]
Sequence
MLRFNFAELKESKFEKYVRPDLIFLVFVLLLVFAVYYFWVSSIESQISAVDSKIARLRAE
KARLLRVQREVGRLKKLEQELKHKLSVVSELERKRHVPQFLYFFGNPDYVKGIWLTELSS
KGKLLHVKGATFNVKRVPLFLQYVETNLGNVVFRETKRKVFSDRRLRLNIPYYQFNFSVE
MKNGAAK
Download sequence
Identical sequences E8T1X2
WP_013537653.1.42620 gi|319789875|ref|YP_004151508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]