SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000045 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000045
Domain Number 1 Region: 432-694
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-77
Family Eukaryotic proteases 0.0000000266
Further Details:      
 
Domain Number 2 Region: 35-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-30
Family Spermadhesin, CUB domain 0.00000124
Further Details:      
 
Domain Number 3 Region: 193-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-28
Family Spermadhesin, CUB domain 0.0000013
Further Details:      
 
Domain Number 4 Region: 375-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0000199
Further Details:      
 
Domain Number 5 Region: 309-378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000115
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 6 Region: 144-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000182
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000045   Gene: ENSFCAG00000000051   Transcript: ENSFCAT00000000050
Sequence length 695
Comment pep:novel genescaffold:CAT:GeneScaffold_1573:12497:25427:-1 gene:ENSFCAG00000000051 transcript:ENSFCAT00000000050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGQLDGCTMRLLLIFLGLLWGSAAAPQGPQWPEPVFGRLASPGFPGEYGNNQDQRWTLRA
PPGYRLGLYFTHFHLELSYLCEYDFVKLSSGTKVLATLCGQESTDTERAPGNDTFYSPAS
SLDVTFHSDYSNEKPFTGFEAFYAAEDIDECQVPPGEAPPCDHHCHNHLGGFYCSCRAGY
VLHRNKRTCSSLCSGQVFTGRSGVLSSPEYPQPYPKLSSCSYSIHLEEGFSIILDFVGSF
DVETHPETLCPYDSLKIQTDKEEYGPFCGTTLPSRIETKSNAVTITFVTDQSGDHTGWKI
HYTSTARPCPGPVAPPNGRLAPVQAQYVLKDRFAVFCETGYELLQGRLPLRSFAAVCQKD
GSWDKPMPQCSIVDCGPPEDLPNGQVQYVTGPEVTTYKAEIQYRCNEIFYTMRSEDGKYV
CGADGFWTSSKGEKSLPVCEPVCGISTRTVRGRIYGGQNAKPGDFPWQVLLLGRTTAAGA
LLQDNWILTAAHAVYEQKEDASSLEIRMGALKRLSAHYTQAWAEAIFIHEGYTHDAGFEN
DIALIKLKNRVVINSNILPICLPRKGAESFMRTNDIGTVSGWGLTQRGFLARSLMFVDIP
TVDHQKCTAAYEKQPYPEGRVTENMLCAGLEGGGKDSCKGDSGGALVFLDNETQTWFVGG
IVSWGSMNCGEANQYGVYTKVVNYIPWIKNIINNF
Download sequence
Identical sequences ENSFCAP00000000045 9685.ENSFCAP00000000045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]