SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000098 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000098
Domain Number 1 Region: 353-602
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-65
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily SRCR-like 0.000000017
Family Scavenger receptor cysteine-rich (SRCR) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000098   Gene: ENSFCAG00000000105   Transcript: ENSFCAT00000000105
Sequence length 611
Comment pep:novel genescaffold:CAT:GeneScaffold_32:18342:51588:-1 gene:ENSFCAG00000000105 transcript:ENSFCAT00000000105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EACSFIFFQRLKIKFQKTIQGREETLKASNMKLAHVILLFLCFYKSFCKLPSTSYIPQKD
LLDNKCLIEKYTHLSCKKVFCQPWQKCIDGTCICKLPYQCPKNGXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXQFSVSLKYGTTTSEGIVEVKLVDQDKKMFICKKAWSI
VEANVACLELGFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXFTVAQEETELLTANMDAERKRIKSLLPKLSCGV
KPIRPTRRKRVVGGKPAEVGDFPWQVAIKDNEKINCGGIYIGGCWILTAAHCVSVSKAHH
YQIWTSFLHLLRREEELVVQLANKIIIHENYNGSSYENDIALIEMKKHSKRKECVLPNSV
PACVPWSPYLFQPNDRCIISGWGREKXXXXXXXXXXXXXXLLDNCSKFYPGRYFDLECAG
TDDGSIDACKGDSGGPLVCQDINNVTYVWGVVSWGENCGKPEFPGIYTKVANYFDWISYH
VGRSLISQYNI
Download sequence
Identical sequences ENSFCAP00000000098 9685.ENSFCAP00000000098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]