SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000100 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000100
Domain Number 1 Region: 323-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-22
Family MAM domain 0.0032
Further Details:      
 
Domain Number 2 Region: 18-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-18
Family MAM domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000100
Domain Number - Region: 621-649
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0174
Family MAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000100   Gene: ENSFCAG00000000107   Transcript: ENSFCAT00000000107
Sequence length 649
Comment pep:novel genescaffold:CAT:GeneScaffold_4902:386630:651085:1 gene:ENSFCAG00000000107 transcript:ENSFCAT00000000107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQLAGALDLPGSCAEENTCGFDSVLQFQPWFLNEEGHYIYVDTSFAKQGEKAVLLSSDLQ
AEEWSCLRLVYQITASSRFLSDTSRLNLYVRFEDESFDRLLWSAKEPSDSWLIASLDLQN
SSKKFKILIEGVLGQGNTASIALFEIKMTTGYCIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVILEVAFNGPKEGM
FALDDISFSPDHCNQTELPFSAMEASCDFEEDLCNFYQDKEGPGWTRVKVKPNMYRAGDH
TSGIGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLRFYYAIYGFLKMSDTLAVYIFEE
NHVVQEKIWSVLESPRGVWMQAEITFKKPMPTKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVIFEAIRGVSIRSDIAIDDVKFQAGPC
Download sequence
Identical sequences ENSFCAP00000000100 9685.ENSFCAP00000000100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]