SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000144 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000144
Domain Number 1 Region: 21-197
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-57
Family Eukaryotic proteases 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000144   Gene: ENSFCAG00000000158   Transcript: ENSFCAT00000000158
Sequence length 261
Comment pep:novel scaffold:CAT:scaffold_100974:2399:5668:1 gene:ENSFCAG00000000158 transcript:ENSFCAT00000000158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISQEYPKILNGTNGTSGFLPGGYTCRPHSQPWQAALLVQKRLLCGGVLVDPKWVLTAAHC
LKEGYRVYLGKHALGRVEAGEQVREVVRSIPHPQYQISPTHLKHDHDIMLLELHSPVQLT
NHIRVVPLSQDCLPAGTCCRVSGWGTTTSPQVSYPPTLQCANIQLRSDEECHQVYPGKIT
PNMLCAGTEEGGKDSCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XETIQKHRTQEWKRTKGKGPQ
Download sequence
Identical sequences 9685.ENSFCAP00000000144 ENSFCAP00000000144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]