SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000160 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000160
Domain Number 1 Region: 425-683
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-71
Family Eukaryotic proteases 0.0000000295
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-29
Family Spermadhesin, CUB domain 0.000000739
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-23
Family Spermadhesin, CUB domain 0.0000922
Further Details:      
 
Domain Number 4 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0000274
Further Details:      
 
Domain Number 5 Region: 300-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000931
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000160   Gene: ENSFCAG00000000175   Transcript: ENSFCAT00000000175
Sequence length 689
Comment pep:novel genescaffold:CAT:GeneScaffold_4244:4530:12555:1 gene:ENSFCAG00000000175 transcript:ENSFCAT00000000175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCVFLFSLLASVYAEPTMYGEILSPNYPQAYPNEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIMSEDFEEGKLCGQRTSKSPNSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVAVDVNECTDFANAPCSHFCNNFMGGYYCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEITSPNYPNPYPENSRCEYQVLLEEGYQVVVTVRREDFDVEPADSGGHCPDSLVF
VARDKQFGPYCGNGFPGPLKIETRSNALNIIFQTDQTEQKRGWKLRYHGDPIPCPKDVTD
NSVWEPEKAKYVFKDVVRITCLEGFEVVQGSVGSRSFYSTCQSDGKWSNSKLKCQPVDCG
IPEPIEHGTVEDPEDTLFGSVIRYTCEEPYYYMENEESGEYRCAGNGSWVNELLGTELPK
CVPVCGVPSKPFVGRQRIFGGSVADIQNFPWQVFFSDPRAGGALIDEYWVLTAAHVVERN
HNPGMYVGSTSVLRSDLTKTKMLTAERVIIHPGWKLLDDPESRKNFDNDIALVQLKEPVK
MGPTVSPICLPGTSSEYNPSVGDLGLISGWGRTEKKDHVRQLRGAKLPIAPLERCREVKG
ENLKLDINAFVFTNNMICAGGQKGVDSCEGDSGGAFAVQIPSVETPKFYVAGLVSWGPQC
GTYGIYTRVKNYIDWIKKTMQENSPPSMD
Download sequence
Identical sequences 9685.ENSFCAP00000000160 ENSFCAP00000000160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]