SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000162 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000162
Domain Number 1 Region: 400-652
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.68e-69
Family Eukaryotic proteases 0.000000013
Further Details:      
 
Domain Number 2 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-27
Family Spermadhesin, CUB domain 0.0000401
Further Details:      
 
Domain Number 3 Region: 24-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-23
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 4 Region: 140-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000978
Family EGF-type module 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000162
Domain Number - Region: 306-348
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00494
Family Complement control module/SCR domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000162   Gene: ENSFCAG00000000177   Transcript: ENSFCAT00000000177
Sequence length 659
Comment pep:novel genescaffold:CAT:GeneScaffold_4244:30185:60273:-1 gene:ENSFCAG00000000177 transcript:ENSFCAT00000000177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLLYLLVMILFCRVEGSIPISQKLFGEVTSPLYPKPYPNNFEKTTVITVPTGFRVKLVFW
QFDLEPSEGCFYDYVKXXXXXXXXXXXXXXXXXXXGNPPEAKEFMSEGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECAAQRNSVEENLQPQCQHLCHNYPGGYFCSCRPGYE
LQKNGHSCQAECSSELYTEPSGYVSSLEYPKPYPPDLRCNYSIRVERGLTLHLKFLEPFE
IDDHQQVHCPYDQLQIYASGRNIGEFCGKQRPADFDSSSNAVDLLFFTDDSGDSRGWKLH
YTTEIIKCPQPKTLDKFTIIQDLQPQYQFRDYFIVTCKQGYQLVESQEERLTGQDGRVGM
GEQRGNGREPEKKAQGGTASQKERTGRAGLTTCLLCLSSPVCGKPVNPVEQKQRIIGGQR
AKLGNFPWQAYTNIYGPGGGALLGDRWILTAAHTLYPKDYNGENNATRDVFLGHVNVEEI
TKLANHPVRRVSIHPDYRQDESNNFEADIALLELENSVTLGPNLLPICLPDNETFYDRGL
MGYVSGFGIMEERLSYDLKFIRLPVGRREACESWLRKKNRNDVFSQNMFCAGDPSLKQDA
CQGDSGGVFAVKDEDNDRWVATGIVSWGIGCGRGYGFYTKLLNYVDWIKKEMGEEEGEG
Download sequence
Identical sequences ENSFCAP00000000162 9685.ENSFCAP00000000162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]