SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000164 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000164
Domain Number 1 Region: 223-478
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.8e-64
Family Eukaryotic proteases 0.000000149
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-23
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 184-231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000379
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000164   Gene: ENSFCAG00000000179   Transcript: ENSFCAT00000000179
Sequence length 481
Comment pep:novel genescaffold:CAT:GeneScaffold_4244:66381:104349:-1 gene:ENSFCAG00000000179 transcript:ENSFCAT00000000179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLRWGNYLWXXXXXXXXXXXXWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPGYPEPY
VKGQEISSDFEAPEGFAVRLVFQDFDLEPSQDCRQDSVTITASGMDPNRFCGQQGSPLGS
PPGQREFVSPGNRLRLTFRAPASSQDRTTGLHRGFLALYQAVGVNHSRPSGGSEAISIAE
DNSSKIQNHCQEPYYQAVPAGALPCTTQGLWKETQDREELPRCEPVCGRPLTPIAQNQEA
LGSSKAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDGVFPWKNRRVDVFLGH
TSLDEMLRLGSHPVRRVVVHPDYRQNESHDFNGDIALLELQHSVPLGPSLLPVCLPDSET
LYRSGVLGYVSGFGVERGWLTTELKYSRLPVAPRAACQAWLQERQRSEVFSDNMFCAGDE
MRHQSVCQGDSGGVYVVWDERAHHWVATGIVSWGVGCGKGYGFYTKVLNYLDWIKGVMGK
D
Download sequence
Identical sequences ENSFCAP00000000164 9685.ENSFCAP00000000164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]