SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000168 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000168
Domain Number 1 Region: 368-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000591
Family Clostridium neurotoxins, the second last domain 0.031
Further Details:      
 
Domain Number 2 Region: 23-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000168
Domain Number - Region: 197-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0328
Family Cadherin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000168   Gene: ENSFCAG00000000183   Transcript: ENSFCAT00000000183
Sequence length 843
Comment pep:novel genescaffold:CAT:GeneScaffold_4244:160410:216531:1 gene:ENSFCAG00000000183 transcript:ENSFCAT00000000183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLLLPLLLASLLPSSSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCETQKEHTFTIQAYDCGEGPDG
ANTKKSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXKDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVQVPLGGTA
GLGSGPQNSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGISFDPALIHDNGLIH
PPRREPALMIGACWTEEKNKEKEKGGDNSTDTTQGDPLPXXXXXXXXXXXXSVRSGRLES
REVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTL
RFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFE
GPEGIPLFPDLQITCSISHQVEAKKDENWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDP
ERESLLLDMASLQQRGLELTNTSAYLTIAGVESITVYEEILRQAHYRLRHGAALYARKFR
LSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHMLSSQQFLHRGHQPPPEMAGHSLASSH
RNS
Download sequence
Identical sequences 9685.ENSFCAP00000000168 ENSFCAP00000000168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]