SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000281 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000281
Domain Number 1 Region: 244-335,399-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-17
Family SPRY domain 0.035
Further Details:      
 
Domain Number 2 Region: 49-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000174
Family SPRY domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000281   Gene: ENSFCAG00000000305   Transcript: ENSFCAT00000000305
Sequence length 442
Comment pep:novel genescaffold:CAT:GeneScaffold_3221:1234030:1247195:-1 gene:ENSFCAG00000000305 transcript:ENSFCAT00000000305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHG
NSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHA
DDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPD
GLFPAVGMHSLGEEVRLHLNAELGREDDSVMMVDSYEDEWGRLHDVRVCGTLLEYLGKGK
SIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHA
DDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVR
NVRNVMYLHQEGEEEEEEEEEEEDGEEIEQEHEGKKVVVFFTRNGKIIGKKDAVVPSGGF
FPTIGMLSCGEKVKVDLHPLSG
Download sequence
Identical sequences A0A091CQ67 A0A1S2ZER6 A0A2I2URQ5 E2RLQ8 E9Q9B3 F1M7P8 L5L7H9 L5MAK0
ENSMUSP00000121493 ENSRNOP00000052188 ENSMUSP00000121493 ENSCAFP00000010537 ENSRNOP00000052188 NP_001028449.2.92730 NP_001178719.1.100692 NP_001178719.1.4139 XP_003988799.1.62641 XP_004406296.1.74151 XP_004649940.1.11716 XP_004692772.1.23501 XP_005397198.1.28644 XP_006741628.1.47382 XP_007518259.1.11023 XP_010607575.1.5607 XP_016056813.1.3490 XP_017525323.1.32401 XP_021542358.1.83697 XP_543638.2.84170 ENSFCAP00000000281 ENSMUSP00000121493 ENSCAFP00000010537 10090.ENSMUSP00000121493 10116.ENSRNOP00000052188 9615.ENSCAFP00000010537 9685.ENSFCAP00000000281 ENSFCAP00000000281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]