SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000461 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000461
Domain Number 1 Region: 106-357
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-65
Family Nuclear receptor ligand-binding domain 0.00000000344
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000461   Gene: ENSFCAG00000000497   Transcript: ENSFCAT00000000496
Sequence length 358
Comment pep:novel genescaffold:CAT:GeneScaffold_5119:78552:85256:-1 gene:ENSFCAG00000000497 transcript:ENSFCAT00000000496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGEDEPRNCAVCGDRATGYHFHALTCEGCKGFFRRTVTRSTGLTCPFAGRCEVNKTQR
RHCPACRLQKCLDAGMKKDMILSAEALALRRAKQAQRRAQRAPSQLSDKQKELVRTLLGA
HTRHVGTMFDQFVQFRPPAHLFVRHQHLPVSVPVPPLLTHFAEINTFMVQQIIKFTKDLP
LFRSLPMEDQISLLKGAAVEMCHIALNTTFCLQTQNFLCGPLHYAIEDGAHASPTVGFQE
QFLELLFRFHGTLRRLQLQEPEYVLMAAMALFSPAPHLLPDRPGVTRREQIDHLQEVTAL
TLQSYIEGQQPRPGSRFLYAKLLGLLAELRSINNAFGYQIRHIQGLAAMMPLLQEICS
Download sequence
Identical sequences 9685.ENSFCAP00000000461 ENSFCAP00000000461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]