SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000623 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000623
Domain Number 1 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000116
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 626-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000158
Family SPRY domain 0.0044
Further Details:      
 
Domain Number 4 Region: 508-581
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000285
Family SPRY domain 0.012
Further Details:      
 
Domain Number 5 Region: 463-513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000109
Family Fibronectin type III 0.004
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000623
Domain Number - Region: 106-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00247
Family ZZ domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000623   Gene: ENSFCAG00000000671   Transcript: ENSFCAT00000000672
Sequence length 715
Comment pep:novel genescaffold:CAT:GeneScaffold_499:32341:130691:1 gene:ENSFCAG00000000671 transcript:ENSFCAT00000000672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCGSGESIEPITAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPSTAMSSERIACQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAMATASSQVLIPDINFNDAFE
NFALDFSREKKLLEGLDYLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYNSVDSWMIVPNIKQNHYTV
HGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDE
SSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXPPQLKRLGVLLDYDNNMLSFYDPANSLHLHTFD
VTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences ENSFCAP00000000623 9685.ENSFCAP00000000623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]