SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000817 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000817
Domain Number 1 Region: 13-52,188-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.63e-17
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 
Domain Number 2 Region: 265-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000817   Gene: ENSFCAG00000000879   Transcript: ENSFCAT00000000879
Sequence length 494
Comment pep:novel genescaffold:CAT:GeneScaffold_3820:17836:54171:-1 gene:ENSFCAG00000000879 transcript:ENSFCAT00000000879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQNIGIKHVPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXIYLRFLDYQMEHSNECKRNFVAVYDGSSSIENLKAKFCSTVANDVMLKTGVGV
IRMWADEGSRLSRFRMLFTSFVEPPCTGSTFFCHSNMCINNSLVCNGVQNCAYPWDENHC
KEKKKAGLFEQITKTHGTIIGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQE
VFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSR
TNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQAHECPEQALEDRVMEEIPCEIYVR
GRDDSAQASISIDF
Download sequence
Identical sequences 9685.ENSFCAP00000000817 ENSFCAP00000000817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]