SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000912 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000912
Domain Number 1 Region: 142-252
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-33
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 2 Region: 299-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 3 Region: 463-575
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.28e-27
Family Frizzled cysteine-rich domain 0.00028
Further Details:      
 
Domain Number 4 Region: 258-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 417-450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000912   Gene: ENSFCAG00000000979   Transcript: ENSFCAT00000000979
Sequence length 578
Comment pep:novel genescaffold:CAT:GeneScaffold_442:80096:85320:-1 gene:ENSFCAG00000000979 transcript:ENSFCAT00000000979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKECSDIILCAEATELSKTEFCNPAFEPESGPPPPAFREDASCSVPAPWHGRRPRGLQPD
CHFSWLCVLLLASLLLLLLGLLVAIILAQLQTTPLPGASYHPLPTQGFTTTTTTTTTTTS
PATGNPKGQLKEAGMSPSPQSSCGGLLPGPRGFFSSPNYPDPYPPNAHCVWHIQVAAGHA
VQLKIEALSMESVASCLFDRLEISPEPEGPLLRVCGKVPPPTLNTNASRLRVAFVSDSSV
EGSGFHAWYQAVTPGNGNCAHDEFPCDQLVCLLPDSMCDGFANCADGSDEANCSTKLLGC
GGNLTGLQGTFSAPSYLQRYPHQQLCTWHISVPAGRGVELQLHNFSLEAQDECELDYVAV
YETSTSGALGLLGRFCGAEPPPRLISSSHQLVVLFRTDRGISSGGFSATYRALNGTENPC
GPGEFSCRDGGCKSLQWMCDTWRDCTDSSNGNCSSPLLPPPELACEPVQVEMCIGLNYNA
TAFPNIWVGMATQEEVMEVLRSYKSLTSLPCYQNFRRLLCGLLVPHCTPTGSVLPPCRSV
CQEAELQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences ENSFCAP00000000912 9685.ENSFCAP00000000912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]