SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000939 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000939
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-36
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 192-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-17
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000939   Gene: ENSFCAG00000001007   Transcript: ENSFCAT00000001006
Sequence length 318
Comment pep:novel genescaffold:CAT:GeneScaffold_2609:132670:223110:-1 gene:ENSFCAG00000001007 transcript:ENSFCAT00000001006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGAWGPLCLLLAAAAQLSRQQPPERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCT
WKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSGN
KMMVQMISDANTAGNGFMAMFSAAEPNERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLIELKFEKFDVERDNYCRYDFVAVFNGGEVNDAKRIGKYCGDSPPAPIV
SERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTVPPVTTTFPVTTGLKPTVALCQQK
CRRTGTLESNYCSSNFRE
Download sequence
Identical sequences ENSFCAP00000000939 9685.ENSFCAP00000000939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]