SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001122 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001122
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001122   Gene: ENSFCAG00000001209   Transcript: ENSFCAT00000001209
Sequence length 160
Comment pep:novel scaffold:CAT:scaffold_211668:13296:16741:-1 gene:ENSFCAG00000001209 transcript:ENSFCAT00000001209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLT
CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEH
PRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences D2HXX2 G7NA66 G7PMB6 G9L0M8 L8IVK8
9615.ENSCAFP00000004729 9685.ENSFCAP00000001122 ENSFCAP00000001122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]