SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001273 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001273
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.64e-45
Family Eukaryotic proteases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001273   Gene: ENSFCAG00000001368   Transcript: ENSFCAT00000001368
Sequence length 190
Comment pep:novel scaffold:CAT:scaffold_8688:1981:5303:-1 gene:ENSFCAG00000001368 transcript:ENSFCAT00000001368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VITAAHCTTKLQVILGITNPSNYDEKDIQVVGYEKMIHHPHFSVTSIEYDLMLIKLREYI
ELNDYVKLVSLPEEPAPEEAMCMVSTWAYNLCDASKDPDSLQNVNISIISRRECHNAYKT
YKIQEGMLCLGIVPGRRLSCKEVTAAPAVCNGVLQGILAFADGCVLRADVGIYTKIFNYM
SWIRNTIKNN
Download sequence
Identical sequences ENSFCAP00000001273 9685.ENSFCAP00000001273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]