SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001428 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001428
Domain Number 1 Region: 196-302
Classification Level Classification E-value
Superfamily Kringle-like 1.93e-31
Family Kringle modules 0.00052
Further Details:      
 
Domain Number 2 Region: 351-537
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.45e-31
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 3 Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000036
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000001428
Domain Number - Region: 71-90
Classification Level Classification E-value
Superfamily Kringle-like 0.00571
Family Fibronectin type II module 0.028
Further Details:      
 
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0893
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001428   Gene: ENSFCAG00000001538   Transcript: ENSFCAT00000001538
Sequence length 537
Comment pep:novel genescaffold:CAT:GeneScaffold_1312:463516:476965:-1 gene:ENSFCAG00000001538 transcript:ENSFCAT00000001538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLFLGSLLGSLESAFLTPPWKAPKEHEHRADEHTVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXCATSPNFEQDQQWAYCLEPKKVKDHCSKHSPCQNGGTCVNMPKGPHCI
CPEHFTGKHCQREKCFEPQLFQFFHEKETWHRLESAGVAECQCKGPDAHCKPLASQVCHT
NPCLNGGSCLEVEGHRLCRCRAGYAGRFCDVDTEARCYDGHGLDYRGTAETALSGARCQP
WASEATYRNVTAEQALNWGLGDHAFCRNPDNDTRPWCFVWSGDRLSWEYCRLARCEPPVL
EALQFLPPTQVPSEHPDFPLPSLSALQKPQPPTPGTLGATEQPTPLPSPSCGQRLTLSSL
SRVVGGLVALWAHPYIXXXXXXXXXXXXNLIASVLTAAQCLKRPPPEELTVVLGQDRHNQ
SCEQCQTLAVRAYRLHEAFSPITYQHDLALLRLQEREDGHCALPSPFVQPVCLPSSAARP
SEAALCEVAGWGHQFEGAGEYSSFLLEAQVPLIPSERCSADVHVSFTSGMLCAGFLE
Download sequence
Identical sequences 9685.ENSFCAP00000001428 ENSFCAP00000001428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]