SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001437 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001437
Domain Number 1 Region: 463-624
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.49e-64
Family Eukaryotic proteases 0.00000868
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000001437
Domain Number - Region: 126-153
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000124
Family Pan module (APPLE domain) 0.047
Further Details:      
 
Domain Number - Region: 40-98
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0322
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001437   Gene: ENSFCAG00000001548   Transcript: ENSFCAT00000001548
Sequence length 637
Comment pep:novel genescaffold:CAT:GeneScaffold_2630:66597:108889:1 gene:ENSFCAG00000001548 transcript:ENSFCAT00000001548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISFRQGAYFTCLFATVSCGCLTQLYKNTFFKGGDLTAMYTPNAEHCQMMCTFHPRCLLF
SFLPESSTNDTDKRFGCFLKDSVTGTLPKCHANTISGHSLKQCGHQISACHRDIHEGIDM
RGVNFNVSKVESVEECQKKCTNSIHCQFFTYATHTFYDAEYRNTCLLKHSAGGTPTSIKL
LANVASGFSLKPCALSEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLPLQDVXXXXXXXXXXXXXXXETPFSRIKEMIIHPNYKMSDSG
DDLALIRLEPPLNYTEFQKPICLPSKDDTNTMYTNCWVTGWGFTKEKGKIQNTLQKANVP
LVSSEECQKKYRDYEVTKQMICAGYKEGGKDACKGDSGGPLVCKHNGIWHLVGITSWGEG
CGRREQPGVYTKVAEYVDWILEKTQVGDGQSLMKSPA
Download sequence
Identical sequences ENSFCAP00000001437 9685.ENSFCAP00000001437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]