SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001693 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001693
Domain Number 1 Region: 174-210
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000115
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001693   Gene: ENSFCAG00000001828   Transcript: ENSFCAT00000001828
Sequence length 417
Comment pep:novel genescaffold:CAT:GeneScaffold_783:281:67308:1 gene:ENSFCAG00000001828 transcript:ENSFCAT00000001828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNLHVETDSTSETSFSLSKEARGEHLDHQAAHQPFPRQRFRQDAGHPSLQRDGPRSFLLD
LPNFPDLSKADINGQNPNIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTDGEGDWSLW
SVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTDSCERWMSCKSEFLKKYMHKVINDLPSCPCSYPTEVAYSTADIFDRIKRKDF
RWKDASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLI
STEFSAELHYKVDVLPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEARE
Download sequence
Identical sequences ENSFCAP00000001693 9685.ENSFCAP00000001693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]