SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001816 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001816
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.32e-32
Family Laminin G-like module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000001816
Domain Number - Region: 1595-1650
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00889
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001816   Gene: ENSFCAG00000001958   Transcript: ENSFCAT00000001963
Sequence length 1804
Comment pep:novel genescaffold:CAT:GeneScaffold_1866:83576:202130:1 gene:ENSFCAG00000001958 transcript:ENSFCAT00000001963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASSFP
EDFSILTTVKAKKGSQAFLVSIYNEQGVQQIGLEMGRSPVFLYEDHTGKPGPEDYPLFRG
INLSDGKWHRIALSIHKKNVTLILDCKKKTTKPLDRSDHPVIDVNGIIVFGTRILDEEVF
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPEGEGEGDAYYYEY
PYYEDTEDPGKEPAPTNKPVEAARETTEIAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEGPRGEKGQKGE
PAIIEPGMLMEGPPGPEGPAGLPGPPGTMGPTGQVGDPGERGPPGRPGLPGADGLPGPPG
TMLMLPFRFGGGGDAGSKGPMVSAQESQAQAILQQARXALRGPAGPMGLTGRPGPMGPPG
SGGLKGEPGDMGPQGPRGVQGPPGPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAG
LPGEKGHRGDPGPSGPPGPPGDDGDRGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPG
VTGMDGQPGPKGNVGPQGEPGPPGQQGNPGAQXXXXXXXXXXXXXXXGPLGKPGLPGMPG
ADGPPXXXXXXXXXXXXXXXGPPGPQGPIGYPGPRGVKCGDSGSGLRAVGGQPPRRWGED
GFPGFKGDMGIKGDRGEIGPPGPRGEDGPEGPKGRGGPNGDPGPLGPPGEKGKLGVPGLP
GYPGRQGPKGSIGFPGFPGANGEKGGRGTPGKPGPRGQRGPTGPRGERGPRGITGKPGPK
GNSGGDGPAGPPGERGPNGPQGPTGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPP
GPPGVVGPQGPTGETGPMGERGHPGPPGPPGEQGLPGLAGKEGTKGDPGPAGLPGKDGPP
GLRGFPGDRGLPGPVGALGLKGSEGPPGPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPP
GPAGEKGAPGEKGPQGPAGRDGLQGPVGLPGPAGPVGPPGEDGDKXXXXXXXXXXXXXXX
XXXGPPGPTGPQGPIGQPGPSGADGEPGPRGQQGLFGHKGDEGPRFPGPPGPVGLQGLPG
PPGEKGETGDVGQMGPPGPPGPRGPSGAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPG
LPGEGGPPGPKGERGEKGESGPSGAAGPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPG
PAGQDGPPGDKGDDGEAGQTGSPGPTGEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAG
LEGPPGKTGPIGPQGAPGKPGPDGLRGIPGPVGEQGLPGAPGPDGPPGPMGPPGLPGLKG
DSGPKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSSGPKGEQGITGPSGPIGPPGPPG
LPGPPGPKGAKGSSGPTGPKGEAGHPGPPGPPGPPGEVIQPLPIQASRTRRNIDASQLLD
DGAGESYVDYADGMEEIFGSLNSLKLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEY
WVDPNQGCSRDSFKVYCNFTAGGATCVFPDKKSEGARITSWPKENPGSWFSEFKRGKLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRKKGYQKTVLEIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPA
CFLG
Download sequence
Identical sequences 9685.ENSFCAP00000001816 ENSFCAP00000001816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]