SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002076 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002076
Domain Number 1 Region: 7-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-81
Family Eukaryotic proteases 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002076   Gene: ENSFCAG00000002251   Transcript: ENSFCAT00000002251
Sequence length 308
Comment pep:novel genescaffold:CAT:GeneScaffold_4039:47991:55868:-1 gene:ENSFCAG00000002251 transcript:ENSFCAT00000002251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSKNRLILLLGMLCVEQCKSATLSLPKAPTCGQSLVKAQPWNYLNIFSRIVGGSQVEK
GSYPWQVSLKRRQKHICGGTIISAQWVITAAHCIANRNIASTLNVTAGEYDLSHIEPGEQ
TLTIETIIIHPYFSIKKPMDYDIALLKMDGAFHFGQFVGPVCLPEPKEEFEAGFICTTAG
WGRSAEDGVVSQVLQDVNLPILTQEECVAALLTLKKPISGQTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNMQEDNQGSPGIFTDLRKVLPWIHKHIQI
GKRRKSSR
Download sequence
Identical sequences ENSFCAP00000002076 9685.ENSFCAP00000002076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]