SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002091 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002091
Domain Number 1 Region: 38-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-32
Family APC10-like 0.0025
Further Details:      
 
Domain Number 2 Region: 1584-1638
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000106
Family ZZ domain 0.018
Further Details:      
 
Domain Number 3 Region: 1629-1689
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000188
Family ZZ domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002091
Domain Number - Region: 934-1008
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00379
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number - Region: 2510-2599
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002091   Gene: ENSFCAG00000002267   Transcript: ENSFCAT00000002267
Sequence length 2765
Comment pep:novel genescaffold:CAT:GeneScaffold_411:38081:182060:-1 gene:ENSFCAG00000002267 transcript:ENSFCAT00000002267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIDIFSESKEGLGVHASLILRFLHRNRLSGMAVPCPMLDHCNNMCSMRVSVLKESLDQLV
QKEKESPGDLTRSPEMDKLKSVAKCYAYIETSSNPADIDKMTNGDTASYWQSDGSARSHW
IRLKMKPDVVLRHLSIAVAATDQSYMPQQVTVAVGRSVGELQDVRDVHIPSNVTGYVTLL
ENANISQLYVQINIKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLV
TASMETNPAFVQTVLHNTQKALQHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCC
STPEVELTLLAFALARGSVAKVLSSLCAITDHLDTRYEASSLISSMASVRQNLLLKYGKP
LQLILQACDVKGKEEKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESAFQVTQIRI
MVRRGGIGAQCGLVFAYNSSSEKFHAEEHFKRFEKYDKWKLQEFRQFVKSRAGCSPGDLG
EEDPVGWFELEEEWDEADVKLQQCRVAQYLMVKFLCTRQESAERLGVQGLSISGHLRPAR
TGAEQHVVCTRCVKDTEDSVCGATLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLD
LQIFWNFYSKLKQNPREECICAQTLLLRLLQSCFSVLRSDGPAASQDAKAPRQSPAGAGA
AKELHTHLCDAVPTETLHEVKNPLLKEPAILFPDQTARNQLFAMXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAQFLASLRVILESLLSQYSG
KTLVEKLCNSVFSMAARQLFCTLDISHCVLLREFSTLPELLKQLCGDPEGGPNTLDVEPW
PQERPVVLHTWTKESAHNYENNCHEVSVFVSPGATCFEVEFDERCETEKRYDYLEFTDAR
GGKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWAS
DLQLLVSRLLGRLAAQCMALKSTHKLGGDVVIPAKVKLIRLPERKPASRPKPQVMARSTC
PRSYCSGEVTCIPEDPCRRLLLEFVQADPAQSCCGPLSELCKGLIQACRKQAPKTDRVAG
STIDQAVNATFAALVCRTPDXXXXXXXXXKSGGHTALSEEFAQVYYLADGIRIWMLEMKQ
KSLMSLGSEAEGRHGSEAAELNPESLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYF
GHLEGCGADLHKEIRDTYYQFVLFLVKAVKGFSSINDRSLLPALSCVQTALLHLLDMGWE
PGDLAFFVDIQLPDLLMKMTQENISVHDSVISQWSEDDELADAKQNSEWMDECQDGMFEA
WYEKIAQEDPEKQRKMHMFIARYSELLHVDISCDGCDEIAPWHRYRCLQCSDMDLCTTCF
LGGVKPEGHGDDHEMVSMEFTCDQCQGLIIGRRMNCNVCDDFDLCYGCYAAKKYSYGHLP
THSVTAHPMVTIRISDRQRLIQPYIHNYAWLLFAALALYSTHLASAEDAGGERLDSRARS
SAAALHSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGDASPQSQAPAVAVPAHTPEEER
AVRVAEGPSHTGPSPHDTGKRDGHKVRPFDCKQRSKEDEGASLMKDPARQTQVSDSPAGL
PDADTSVVSSQKPIEEKAVTPSPEQVFAECSQKRILGLLAAMLPPLKLDPAVPVIDLERA
LPLMFQVVISNAGHLNETYHLTLGLLGQLITRLLPAEVDAAVVKVLSAKHTLFAAGDSSV
VPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLSGAPLWRDVIATFTDHCIKQLP
FQLKHTNIFTLLVLVGIPQVLCVGTRCVYVDNANEPHDVIILKHFTEKNRAVVVDVKTRK
RKTVKDYQLVQKGQECNDCQAQLSQYSQHFAFIASHLLQTSMESHCPEAVEATWVLSLAL
KGLYKTLKAHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYSSKKE
IHTSVEHTGLEPDERGDQGEDTEGAVSSPGEQEQRKLDPLESLDEPTRICFLMAHDALNA
PLHVLRAIYELQMKRTDSFFLEVQKRFDGDELTTDERIRTLAQRWQPSRSLRLDEQSAKA
VDTDMIILPCLSRPARCDQATAESNPVTQKLISSTEGELQQSYAQQRRSKSAALLHKELG
CKSRRAVREYLFRVNEATAVLYARHVLASLLAEWPGHVPVSEETLELSGPAHMTYILDMF
MQLEEKHQWEKILRKVLQGCRGSMLGTMALAACQFMEEPGMEVQVRESKHPYNNNTNFED
KVHIPGAIYLSIKFDAQCSTEEGCDELAMSSSSDFQQDRHTFSGSQQKWKDFELPGDTLY
YRFTSDMSNTEWGYKFTVTAGHLGRFQTGFEILKQMLSEERVVPHLPLAQIWEWLVGVAC
RQTGHQRLKAIHLLLRIVRCCTHSDLCDLTLLKPLWQLFTHMEYSLFEDVTQPGILLPLH
RALTELFLVTENRAQELGLLQEYLLALTTDDHLLRCAAQALQNIAAISLAINYPNKATRL
WNVKC
Download sequence
Identical sequences ENSFCAP00000002091 9685.ENSFCAP00000002091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]