SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002158 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002158
Domain Number 1 Region: 49-293
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-80
Family Eukaryotic proteases 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002158   Gene: ENSFCAG00000002338   Transcript: ENSFCAT00000002338
Sequence length 326
Comment pep:novel genescaffold:CAT:GeneScaffold_4454:2014:13062:1 gene:ENSFCAG00000002338 transcript:ENSFCAT00000002338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRPSVLCLLGPAAPGLILLLLLLPPTQVAAIAHGHPRIEGVSLNRDVACGHRYIQGKI
VGGVDVPERKWPWQVSVHYAGFHVCGGSIIDEYWILSAAHCFQKEKNTEAFDMYVGLVDL
RVAGNHTQWFEVNKVIIHPTYEVYHPIGGDIALVQLKSRIVFSDSVLPVCVAPPDVNLQN
VICWATGWGVISQQGHTSDKLQEAQMPLISLPLCQLLYGHLSYIMMDMLCAGDIKNMKTV
CEGDSGGPLVCEFNHTWLQVGVVSWGRGCTYPMYPAVYARVSYFSKWIHYHIEHTPLPLQ
PLPTLSSMLCATLSVPVTMLAVLLML
Download sequence
Identical sequences 9685.ENSFCAP00000002158 ENSFCAP00000002158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]