SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002219 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002219
Domain Number 1 Region: 723-835
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-32
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 2 Region: 1767-1886
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 3 Region: 559-663
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1944-2051
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-31
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 5 Region: 382-492
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-29
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 6 Region: 2295-2399
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1074-1183
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 8 Region: 901-1009
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1247-1293,1467-1529
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.49e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 179-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-18
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 11 Region: 3030-3101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 12 Region: 3090-3159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 319-391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 14 Region: 2731-2788
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000553
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 115-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 16 Region: 1885-1947
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000297
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 17 Region: 3210-3267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 1186-1249
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000216
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 3142-3204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 20 Region: 497-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 21 Region: 1534-1601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 22 Region: 668-736
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 23 Region: 1016-1078
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 24 Region: 2401-2462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 25 Region: 1595-1704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000466
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 26 Region: 2228-2291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000625
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 27 Region: 1711-1774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000862
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002219
Domain Number - Region: 72-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00157
Family Spermadhesin, CUB domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002219   Gene: ENSFCAG00000002406   Transcript: ENSFCAT00000002406
Sequence length 3567
Comment pep:novel genescaffold:CAT:GeneScaffold_1598:72987:861377:-1 gene:ENSFCAG00000002406 transcript:ENSFCAT00000002406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNCTFQLQGPNGTVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLTGFQLPATIVSVATTLSLRLISDYAVSAQGFHASYEVLPSHTCGNPG
RLPNGVQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGSENSATWDFPLPSCRADDACG
GTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDGYDFLEVTGTEG
SSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKQIELKSRGVKLMPSKD
NSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCSEGYDLQGSKRITC
MKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVWIITALNPAKV
IKLAFEDFDLERGYDTLTVGDGGQDGDQKTVLYVLTGTSVPDLIVSTNHQMWLLFQTDGS
GSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFRHGDTLKFECQPAFELVGQKAITCQK
NNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILARPESRIHLAFNDI
DVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFNITF
TTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCILKEGSVVWNS
AVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKITFDRFKTEVNY
DTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQLRYEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
CGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLESGHDYLLITEN
GSFSQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFAEYDLEPCEEPE
VPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAECGNSVT
GTQGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLKARTFELSEGDVLKVYDGNNKSARL
LGVFSRSEMMGVTLNSTSSSLWLDFITDAENTSKGFELQFSSFELIKCEDPGTPQFGYKV
HDGGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRTWDRPLPTCVAECGGTVKGEVSGQV
LSPGYPAPYEHNLNCIWTIEADAGCTIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCGGDLSGPSGVILSXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXFNLEPGYDFLHIYDGRDSLSPLIGSFYGSQLPAR
IESSSNSLFLAFRSDASVSSAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKLGSSITYY
CHGGYEVEGASTLSCILGPDGKPAWNNPRPVCTAPCGGQYVGSDGVVLSPNYPQNYTSGQ
ICLYFVTVPKDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESLPLATSN
QVLIKFSAKGPAPARGFHFVYQAVPRTSATQCSSVPEPXXXKRLGSDFSVGAIVRLDCNS
GYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPYLNSLNCV
WKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNQLY
LHFYSDISVSAAGFHLEYKTVGLSSCPEPTVPSNGVKTGERYLVNDVVSFQCEPGYALQG
HAHISCMPGTVRRWNYPPPLCIAQCGGAVEEMEGVILSPGFPGNYPSNMDCSWKIALPVG
FGAHIQFLNFSTEPNHDFIEIRNGPYETSRMMGRFSGSELPGSLLSTSHETTVYFHSDHS
QNRPGFKLEYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNELTCKLGTYLQFEG
PPPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQTCSWLVRVEPDYNISLTVEYFLSEK
QYDEFEIFDGPSRKSPQLKTLSGNYSAPLIVTSSSNTVYLRWSSDHAYNRKGFKIRYSAP
YCSLPRAPLHGFLLGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYYLWSEAIPLC
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITCGHPGNPINGLTQGNQFNLNDVVKFVCN
PGYMAEGAARSQCLASGQWSDTLPTCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXCIVINCGDPGIPANGLRLGNDFRYNKTVTYQCVP
GYMMESHRVSVLSCTKDRTWNGTKPVCKAIICKPPQLIPNGKVVGSDFMWGSSVTYACLE
GYQLSLPAVLTCEGNGSWTGELPQCFPVFCGDPGVPARGRREDRGFSYRSSVSFSCQPPL
VLVGSPRRFCQSDGTWSGTQPSCIDPTLTMCADPGVPQFGIQNNSQGYQVGSTVLFRCQK
GYLLQGSTTRTCLPNLTWSGTPPDCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVRPSGRPINTAREPPLTQASVPGDVFAKNSLWK
GAYEYQGKKQPAMLRVTGFQVVNSKVNATMIDHSGVEVHLAGIYKKEDFHLLLQVYQITG
PAEIFVNKFKDDHWALDGHVSSESPGGTFIYQGSVKGQGFGQFGFQRLDLRLLESDPESI
GRHFASNSSSVAAAILVPFVALIIAGFVLYLYKHXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXNIQPTDIMATEAEFTVSTVCTAV
Download sequence
Identical sequences 9685.ENSFCAP00000002219 ENSFCAP00000002219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]