SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002227 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002227
Domain Number 1 Region: 1010-1123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-52
Family Thrombospondin C-terminal domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-39
Family Laminin G-like module 0.0000106
Further Details:      
 
Domain Number 3 Region: 846-925
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.19e-19
Family TSP type-3 repeat 0.0000116
Further Details:      
 
Domain Number 4 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.62e-16
Family TSP-1 type 1 repeat 0.00011
Further Details:      
 
Domain Number 5 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000432
Family TSP-1 type 1 repeat 0.0000875
Further Details:      
 
Domain Number 6 Region: 717-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000144
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 7 Region: 382-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 8 Region: 766-806
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000759
Family TSP type-3 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002227
Domain Number - Region: 348-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.0091
Family VWC domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002227   Gene: ENSFCAG00000002420   Transcript: ENSFCAT00000002420
Sequence length 1123
Comment pep:novel genescaffold:CAT:GeneScaffold_1268:989814:1025746:-1 gene:ENSFCAG00000002420 transcript:ENSFCAT00000002420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWDLVLLALWAASGARAGDQDEDTAFNLFSISNINRKTIGAKQFRGPDPNVPAYRFVRF
DYIPPVSADYLSKIAKIVRQKEGFFLTASLKQDPKSRGTLLALEGPGASQRQFEIVSNGP
ADTLDLTYWIDGAQHVISLEDVGLADSQWKNITVQVTGETYSLYVGCDLIDSFTLDEPFY
EQLRTEKSRMYVAKGSARDNHFRGLLQNIYLVFENSVEDVLSKKGCQQSQGAEANAISEN
TETLHLSPQVATEYAGPGAHRRPEVCERSCEELGTMITELSGLHVIVNQLHENLRKVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFKTVCHQITCPPATC
ANPSFVEGECCPSCFHSLDGEEGWSPWAEWTQCSATCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLGKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKGCQGTPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVQER
QMCNKRSCPVDGCLSNPCFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNC
PLLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTDIDNDLVGDQCDNNDDIDDDGHQNNQDNCPYIPNANQADHDHDGQGDACDSDD
DNDGVPDDRDNCRLVSNPGQEDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEEQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTQGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYI
Download sequence
Identical sequences 9685.ENSFCAP00000002227 ENSFCAP00000002227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]