SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002361 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002361
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily SRCR-like 1.19e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 125-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000641
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002361   Gene: ENSFCAG00000002563   Transcript: ENSFCAT00000002563
Sequence length 184
Comment pep:novel genescaffold:CAT:GeneScaffold_4306:140051:145478:1 gene:ENSFCAG00000002563 transcript:ENSFCAT00000002563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGSGRCSGRVEVLHQEAWGTVCDDLWDLNEAEVVCRQLGCGWAVSALGKAHFGPGSGDI
FLDNVQCSGMEHSLGQCAHLGWSEHNCGHHEDAGVICSGAEELPPPTPPGLSTASQDHIT
GGTSSCGGVMSSVSGSFSSPLYPESYPTDIQCVWEIHVDKKFRIELMIPTLNIMQPDIYP
SPLH
Download sequence
Identical sequences ENSFCAP00000002361 9685.ENSFCAP00000002361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]