SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002363 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002363
Domain Number 1 Region: 25-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-16
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 124-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000929
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002363   Gene: ENSFCAG00000002565   Transcript: ENSFCAT00000002565
Sequence length 567
Comment pep:novel genescaffold:CAT:GeneScaffold_4306:216247:223117:-1 gene:ENSFCAG00000002565 transcript:ENSFCAT00000002565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSCRATVGGTSQSDAHRALILQLNPNEDCTWTLEKPENKSIRIFSHFQLDPSGGCKNEN
IKVFDGNSTKGSLLGKVCSKHDYVPVFESSSDTLTVQIVTDSVRMQRTVFIFYYYFSPGT
SIPNCGGYLDASEGSFTSPNYPNPHPALAYCVWHIQVEKDYKIKLHFKDIXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSCSTSPMSD
FASPVYHLVRSRCNQDKTRKAYPLFGPYGRFQFHAFKVLRDLGSAHLQCQVLICDSSDHE
SRCNQGRVSRRKGNVSSNKWKTNIIELIHPKRDTASGVTGFQYQIHAEKSQNQPANSLAL
SVVIATFIVRHFVNQRIHCKYQKLLDY
Download sequence
Identical sequences 9685.ENSFCAP00000002363 ENSFCAP00000002363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]