SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002387 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002387
Domain Number 1 Region: 14-209
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.18e-57
Family Prokaryotic proteases 0.00000087
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002387
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00672
Family HtrA-like serine proteases 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002387   Gene: ENSFCAG00000002591   Transcript: ENSFCAT00000002590
Sequence length 319
Comment pep:novel genescaffold:CAT:GeneScaffold_2726:278645:289116:1 gene:ENSFCAG00000002591 transcript:ENSFCAT00000002590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRSVGRLRSKYNFIAAVVEKVAPSVVHLQLFRRSPLSSKDIPASSGSGFIVSEDGLIVTN
AHVLTNQQRIQVELQSGVQYEATVKDIDHKLDLALIKIEPNTDLPVLLLGRSSDLWAGEF
VVALGSPFSLQNTVTAGIVSTTQRGGKELGLKDSNMDYIQTDAIINHGNSGGPLVNLDGD
VIGINTLKVTAGISFAIPSDRIRQFLAEFHERQLKGKALSQKKYLGLRMLPLTMNLLQEM
KRQDPDFPDVSSGVFVYEVIQGTAAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRDSLS
KKGSGEVKLSMTVTTKIIN
Download sequence
Identical sequences ENSFCAP00000002387 9685.ENSFCAP00000002387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]