SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002401 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002401
Domain Number 1 Region: 4-252
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.88e-88
Family Eukaryotic proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002401   Gene: ENSFCAG00000002606   Transcript: ENSFCAT00000002606
Sequence length 306
Comment pep:novel genescaffold:CAT:GeneScaffold_2805:206800:208201:-1 gene:ENSFCAG00000002606 transcript:ENSFCAT00000002606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAFCGVASQARITGGSSAAAGQWPWQVSITYDGTHACGGSLVSEQWVLSAAHCFPREHVK
EDYEVKLGAHQLDSYTPEAEVRTVAQVISHSSYHQEGSQGDIALLRLSSPVTFSRYIRPI
CLPAANASFPNGLQCTVTGWGHVAPSVSLLAPRQLQQLEVPLISRETCNCLYNIDAKPEE
PHFIQQDMLCAGYVKGGKDACQGDSGGPLSCLVGGLWYLAGIVSWGDACGAPNRPGVYTL
TSSYASWIHYHVTELQPRVVPQIQESQPDGHLCVNHQAFNSAPAQAVLGLILLLPLGLSL
GLLLSS
Download sequence
Identical sequences 9685.ENSFCAP00000002401 ENSFCAP00000002401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]