SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002402 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002402
Domain Number 1 Region: 27-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.51e-84
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 585-808
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-32
Family Eukaryotic proteases 0.0017
Further Details:      
 
Domain Number 3 Region: 320-368
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000156
Family Eukaryotic proteases 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002402
Domain Number - Region: 514-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00107
Family Eukaryotic proteases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002402   Gene: ENSFCAG00000002607   Transcript: ENSFCAT00000002607
Sequence length 855
Comment pep:novel genescaffold:CAT:GeneScaffold_2805:215903:224874:-1 gene:ENSFCAG00000002607 transcript:ENSFCAT00000002607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQHLLLPFVILAISPIPGALQDSALSPTQEEPEDLDCGRPEPSTRIMGGSEAQPGSWPW
QVSLHQRGGHICGGSLIAPSWVLSAAHCFVTNGTLEPATEWSVLLGVHSQDGPLDSAHAR
AVAAILVPDNYSSVELGADLALLRLASPARLGPAVRPICLPRASHRFAHGTACWATGWGD
IQEADPLPLPWALQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPEGRRDTCQ
GDSGGPLVCEEGGQWFQAGITSFGFGCGRRNRPGVFTAVAPYEAWIREQVMGSEPGPAFP
TQSWEPQPGPWEPTDENCTIALPECGKAPRPGTWPWEARVMVPGSRPCHGALVSESWVLA
PASCFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXNYSHWSLLCQEEGTWFLAGISDFSSGCLRPRAF
YPLQTHGPWISHVTRGAYLEDQLTWDWGPEGEETETQACPPHTEHGACGLRPEPAVMGIL
WPWLAEVHVAGNQVCTGILVAPGWVVAATHCVLRPGFTTVPYIEVYLGRAGASPLPQGHQ
VSRLVISIRLPRHLGLRPPLALLELSSRVEPSPSALPICLHPGGIPLGASCWVLGWKDPR
DRVPVAAAVSILTPRLCHCLYQGILPPGTLCVLYSEGQEDRCEVTSAPPLLCQTEGGSWV
LMGMAVRGSRELFAAIGPEEAWIAQTVGEAHFLPPNGYPHWPPEGSDLCPPDLARASGSP
QAVCSLLLLLPLIQG
Download sequence
Identical sequences 9685.ENSFCAP00000002402 ENSFCAP00000002402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]