SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002443 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002443
Domain Number 1 Region: 368-421
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000575
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 2 Region: 262-306
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000824
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 3 Region: 421-476
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002443
Domain Number - Region: 14-95
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00822
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002443   Gene: ENSFCAG00000002654   Transcript: ENSFCAT00000002654
Sequence length 1492
Comment pep:novel genescaffold:CAT:GeneScaffold_2112:3278:740180:1 gene:ENSFCAG00000002654 transcript:ENSFCAT00000002654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFSKKDLSCSNFSLLAYQFD
HFSHEKIKDLLRKNHSIMQLCDSKNAFVFLQYDKNFIQIRRVFPTDFPGLQKKGEEDQKS
FFEFLVLNKVSPSQFGCHVLCTWLESCLKSENGRTESCGIMYTKCTCPQHLGEWGIDDQS
LVLLNNVVLPLNEQTEGCLTQELQTTQVCNLTREAKRPPKEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXESGVEEWSQWSTCSVTCGQGSQVRTRTCVSPYGTHCSGPLR
ESRVCNNTALCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDGQWQEWSSWSQCSVTCSNGTQQRSRQCTAAAHGGSECRGPWAESRECYNPE
CTANGQWNQWGHWSGCSKSCDGGWERRIRTCQGAAITGQQCEGTGEEVRRCSEQRCPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTSRRCSLSLHGVAFWEQPSFARCISNE
YRHLQHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNFYAGDLLMSVEILRNVTDTFK
RASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIELMQVIEDFIHIVGMGMMD
FQNSYLMTGNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXLDESSVFVLGAVLYKNLDLILPTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNESLGTWSTQGCKTVLTDASHTKCLCDRLSTFAILAQQPREIIM
ESSGTPSVTLIVGSGLSCLALITLAVVYAALWXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLK
SFNPLISYSVKGTKRLGWDPAXXXXXXXXXXXXXXXXXXXXXXVNMVIGILVFNKLVSRD
GILDKKLKHRAGQMSEPHSGLTLKCAKCGVVSTTALSATTASNAMASLWSSCVVLPLLAL
TWMSAVLAMTDKRSILFQILFAVFDSLQGFVIVMVHCILRREXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXTDFEKDVDIACRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXRRKSRYSDLDFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENPAPNKNPWD
TFKNPSEYQHYTTINVLDTEAKDALELRPAEWEKCLNLPLDVQEGDFLTEVL
Download sequence
Identical sequences 9685.ENSFCAP00000002443 ENSFCAP00000002443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]