SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002661 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002661
Domain Number 1 Region: 2-225
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-72
Family Eukaryotic proteases 0.000000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002661   Gene: ENSFCAG00000002893   Transcript: ENSFCAT00000002890
Sequence length 228
Comment pep:novel scaffold:CAT:scaffold_144575:5359:7184:-1 gene:ENSFCAG00000002893 transcript:ENSFCAT00000002890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIIGGHEAKPHSRPYMAHLWIQNREVCSKCGGFLIQEKFVLTAAHCWGSSINVTLGAHNI
KKQEKTQQIIPVRRAIPHPDYNPKNYSNDIMLLQLVKKAKLTAAVRPLGLPKGKDRVRPG
QVCSVAGWGRVATGRYPDTLQEVELIVQEDQECKSRFPNYYNHKTQLCMGDPKEKKSSFQ
GDSGGPLLCNNVAQGIVSYGLKDRASPRAYTKVTSFLPWIKKTMKGLF
Download sequence
Identical sequences ENSFCAP00000002661 9685.ENSFCAP00000002661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]