SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002733 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002733
Domain Number 1 Region: 221-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 105-214
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000523
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002733   Gene: ENSFCAG00000002964   Transcript: ENSFCAT00000002964
Sequence length 323
Comment pep:novel genescaffold:CAT:GeneScaffold_3243:370374:393101:1 gene:ENSFCAG00000002964 transcript:ENSFCAT00000002964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGSRTKITVKTYLPLLLVSCQRSPQPGLPKDPKPKILQVCPTAGHSRAWMKACLPQLPQR
LLLLGAAALAASALETADLVDLCGQTWQGDGLLLRSHAASRRFYFVAPDTDCGLWMRAAA
PGDRIRFQFRFFLVYSLAAAPPAPNASSPEPADPCAPGSYLQFYEGPPGAPRALGAPLCG
LTIPAPVASSGPFLGLRLLTRGRQPRVDFVGEVTSFRLGSCGAYFRCRTGRCIPWSLVCD
RWGVDNCGDGSDQASWPPADCRGPSLVPSQARATDGHTSQPLTPSPALRSAGPLQMAAER
SPLAGRALEEGDTAAPPGGATES
Download sequence
Identical sequences 9685.ENSFCAP00000002733 ENSFCAP00000002733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]