SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002838 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002838
Domain Number 1 Region: 209-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-36
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 85-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000103
Family MAM domain 0.033
Further Details:      
 
Domain Number 3 Region: 173-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002838
Domain Number - Region: 1-46
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0019
Family MAM domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002838   Gene: ENSFCAG00000003081   Transcript: ENSFCAT00000003081
Sequence length 346
Comment pep:novel genescaffold:CAT:GeneScaffold_4904:4940:14067:1 gene:ENSFCAG00000003081 transcript:ENSFCAT00000003081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFEANSCGWFEAISGDHFDWIWNSRSNLSAEFEQQAPPWDHTHRTAQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFYNYGLSVGAAELQLHVENSSDPTVLWRVLYNQGNQ
WSQATIQLGRLTQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEEPDFFWCRH
TKACIEKLLLCDLVDDCGDHTDEANCVPELQCNFENGICNWEQDTEDDFDWTRKHGPTPT
LNTGPMKDNTWGTAKGHYLYIESSEPQVFQNRAALLSPVLNATDADGCTFRFYYHMFGKH
IYRLAIYQRVWSNTRGQLLWQIFGNQGNRWTRTRLNISSRRPFQVW
Download sequence
Identical sequences 9685.ENSFCAP00000002838 ENSFCAP00000002838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]